SAB2102721

XK antibody from MilliporeSigma / Merck KGaA
Kx, NA, NAC, X1k, XKR1
No application information provided.

Antibody data

Product number
SAB2102721
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2102721, RRID:AB_10600066
Product name
Anti-XK (ab1) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2102721
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_066569.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKK
RQMPKNGLSEEIEKE
Storage
-20C
Provider Type Product Number
- No reagents -