HPA019036

XK antibody from Atlas Antibodies
Kx, NA, NAC, X1k, XKR1

Antibody data

Product number
HPA019036
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019036, RRID:AB_1846286
Product name
Anti-XK
Provider product page
Atlas Antibodies - HPA019036
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGN
NEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLI
THRSAFSRA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.