HPA003938

DYNLT3 antibody from Atlas Antibodies
TCTE1L, TCTEX1L
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003938
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003938, RRID:AB_1847920
Product name
Anti-DYNLT3
Provider product page
Atlas Antibodies - HPA003938
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQW
TASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGF
HTASSCFWDTTSDGTCTVRWE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -