HPA003938

DYNLT3 antibody from Sigma-Aldrich
TCTE1L, TCTEX1L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003938
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003938, RRID:AB_1847920
Product name
Anti-DYNLT3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003938
Antibody type
Polyclonal
Antigen
Dynein light chain Tctex-type 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQW
TASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGF
HTASSCFWDTTSDGTCTVRWE
Storage
-20C
Provider Type Product Number
- No reagents -