Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182635 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interferon Regulatory Factor 4 (IRF4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IRF4 antibody: synthetic peptide directed towards the N terminal of human IRF4
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSH
PYTMT TPYPSLPAQQ- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Differential expression of IFN regulatory factor 4 gene in human monocyte-derived dendritic cells and macrophages.
Lehtonen A, Veckman V, Nikula T, Lahesmaa R, Kinnunen L, Matikainen S, Julkunen I
Journal of immunology (Baltimore, Md. : 1950) 2005 Nov 15;175(10):6570-9
Journal of immunology (Baltimore, Md. : 1950) 2005 Nov 15;175(10):6570-9
No comments: Submit comment
No validations: Submit validation data