HPA002038

IRF4 antibody from Sigma-Aldrich
LSIRF, MUM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002038
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002038, RRID:AB_1079148
Product name
Anti-IRF4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002038
Antibody type
Polyclonal
Antigen
Interferon regulatory factor 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQ
LTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPP
LDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGP
ACENGCQVTGTFYACAPPE
Storage
-20C
Provider Type Product Number
- No reagents -