HPA026074

SYTL5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026074
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026074, RRID:AB_1857697
Product name
Anti-SYTL5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026074
Antibody type
Polyclonal
Antigen
Synaptotagmin-like protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KQVNVLGTDVVRQSILRRSPAEEVQSQEQTRQDAE
KSDTSPVAGKKASHDGPKRKGFLLSKFRSATRGEI
ITPKTDTGRSYSLDLDGQHFRSLKSPPGSDRGSTG
SSDLNDQEP
Storage
-20C
Provider Type Product Number
- No reagents -