HPA002267

IRF8 antibody from Atlas Antibodies
ICSBP, ICSBP1, IRF-8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002267
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002267, RRID:AB_611565
Product name
Anti-IRF8
Provider product page
Atlas Antibodies - HPA002267
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVV
QVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEF
PDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGS
VMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQI
T
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -