HPA016419

TDRKH antibody from Sigma-Aldrich
TDRD2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016419
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016419, RRID:AB_1857870
Product name
Anti-TDRKH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016419
Antibody type
Polyclonal
Antigen
Tudor and KH domain-containing protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLPFQAIECSLARIAPSGDQWEEEALDEFDRLTHC
ADWKPLVAKISSYVQTGISTWPKIYLYDTSNGKKL
DIGLELVHKGYAIELPEDIEENRAVPDMLKDMATE
TDASLSTLLTETKKSSGEITHTLSCLSLSEAASMS
GDDN
Storage
-20C
Provider Type Product Number
- No reagents -