HPA002727

NRXN3 antibody from Sigma-Aldrich
C14orf60, KIAA0743
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002727
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002727, RRID:AB_1079468
Product name
Anti-NRXN3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002727
Antibody type
Polyclonal
Antigen
Neurexin 3 isoform alpha precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKV
LNMAAENNPNIKINGSVRLVGEVPSILGTTQTTSM
PPEMSTTVMETTTTMATTTTRKNRSTASIQPTSDD
LVSSAECSSDDEDFVECEPSTANPTEP
Storage
-20C
Provider Type Product Number
- No reagents -