Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405775 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chromosome 21 Open Reading Frame 56 (C21orf56) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-C21orf56 antibody: synthetic peptide directed towards the middle region of human C21orf56
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
EKLGYSRDVHPAFSEFLINTYGILKQRPDLRANPL
HSSPA ALRKLVIDVV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The LIFEdb database in 2006.
Mehrle A, Rosenfelder H, Schupp I, del Val C, Arlt D, Hahne F, Bechtel S, Simpson J, Hofmann O, Hide W, Glatting KH, Huber W, Pepperkok R, Poustka A, Wiemann S
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
No comments: Submit comment
No validations: Submit validation data