HPA018979

SPATC1L antibody from Sigma-Aldrich
C21orf56
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018979
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018979, RRID:AB_1845696
Product name
Anti-C21orf56 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018979
Antibody type
Polyclonal
Antigen
Uncharacterized protein C21orf56 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSVDERKLRELTQRYLALSARLEKLGYSRDVHPAF
SEFLINTYGILKQRPDLRANPLHSSPAALRKLVID
VVPPKFLGDSLLLLNCLCELSKEDGKPLF
Storage
-20C
Provider Type Product Number
- No reagents -