HPA023873

C9orf72 antibody from Atlas Antibodies
DENND9, DENNL72, MGC23980
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023873
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023873, RRID:AB_1845834
Product name
Anti-C9orf72
Provider product page
Atlas Antibodies - HPA023873
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRI
WMHKERQENVQKIILEGTERMEDQGQSIIPMLTGE
VIPVMELLSSMKSHSVPEEI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -