H00203228-B01P

C9orf72 antibody from Abnova Corporation
DENND9, DENNL72, MGC23980

Antibody data

Product number
H00203228-B01P
Provider
Abnova Corporation
Product name
C9orf72 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00203228-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C9orf72 protein.
Antigen sequence
MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDN
ILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGE
ILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNG
DRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIR
KGRIWMHKERQENVQKIILEGTERMEDQGQSIIPM
LTGEVIPVMELLSSMKSHSVPEEIDIADTVLNDDD
IGDSCHEGFLLNAISSHLQTCGCSVVVGSSAEKVN
KIVRTLCLFLTPAERKCSRLCEAESSFKYESGLFV
QGLLKDSTGSFVLPFRQVMYAPYPTTHIDVDVNTV
KQMPPCHEHIYNQRRYMRSELTAFWRATSEEDMAQ
DTIIYTDESFTPDLNIFQDVLHRDTLVKAFLDQVF
QLKPGLSLRSTFLAQFLLVLHRKALTLIKYIEDDT
QKGKKPFKSLRNLKIDLDLTAEGDLNIIMALAEKI
KPGLHSFIFGRPFYTSVQERDVLMTF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -