HPA023873

C9orf72 antibody from Sigma-Aldrich
MGC23980
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023873
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023873, RRID:AB_1845834
Product name
Anti-C9orf72 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023873
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf72 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRI
WMHKERQENVQKIILEGTERMEDQGQSIIPMLTGE
VIPVMELLSSMKSHSVPEEI
Storage
-20C
Provider Type Product Number
- No reagents -