Antibody data

Product number
H00005213-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005213-M04, RRID:AB_1578651
Product name
PFKM monoclonal antibody (M04), clone 1D1
Provider product page
Abnova Corporation - H00005213-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PFKM.
Antigen sequence
AKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRK
RALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILK
ILAKYEIDLDTSDHAHLEHITRKRSGEAAV
Isotype
IgG
Antibody clone number
1D1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -