HPA002117

PFKM antibody from Atlas Antibodies
PFK-1, PFKX, PPP1R122
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002117
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002117, RRID:AB_1855245
Product name
Anti-PFKM
Provider product page
Atlas Antibodies - HPA002117
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVY
KLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSY
VGGWTGQGGSKLGTKRTLPKKSFEQISA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -