HPA002117

PFKM antibody from Sigma-Aldrich
PFK-1, PFKX, PPP1R122
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002117
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002117, RRID:AB_1855245
Product name
Anti-PFKM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002117
Antibody type
Polyclonal
Antigen
6-phosphofructokinase, muscle type recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVY
KLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSY
VGGWTGQGGSKLGTKRTLPKKSFEQISA
Storage
-20C
Provider Type Product Number
- No reagents -