HPA024256
antibody from MilliporeSigma / Merck KGaA
Targeting: BPIFB1
bA49G10.6, C20orf114, dJ1187J4.1, LPLUNC1, MGC14597, VEMSGP
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024256 - Provider product page

- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-C20orf114 antibody produced in rabbit
- Antibody type
- Polyclonal
- Antigen
- Long palate, lung and nasal epithelium carcinoma-associated protein 1 Precursor recombinant protein epitope signature tag (PrEST)
- Description
- affinity isolated antibody
- Reactivity
- Human
- Antigen sequence
PKVIKEKLTQELKDHNATSILQQLPLLSAMREKPA
GGIPVLGSLVNTVLKHIIWLKVITANILQLQVKPS
ANDQELLVKIPLDMVAGFNTPLVKTIVEFHMTTEA
QATIRMDTSASGPTRLVLSDCATSH- Storage
- -20C
No comments: Submit comment
No validations: Submit validation data