HPA024256

BPIFB1 antibody from Sigma-Aldrich
bA49G10.6, C20orf114, dJ1187J4.1, LPLUNC1, MGC14597, VEMSGP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024256
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024256, RRID:AB_1845664
Product name
Anti-C20orf114 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024256
Antibody type
Polyclonal
Antigen
Long palate, lung and nasal epithelium carcinoma-associated protein 1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKVIKEKLTQELKDHNATSILQQLPLLSAMREKPA
GGIPVLGSLVNTVLKHIIWLKVITANILQLQVKPS
ANDQELLVKIPLDMVAGFNTPLVKTIVEFHMTTEA
QATIRMDTSASGPTRLVLSDCATSH
Storage
-20C
Provider Type Product Number
- No reagents -