Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002618-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002618-M01, RRID:AB_425446
- Product name
- GART monoclonal antibody (M01), clone 4D6-1D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant GART.
- Antigen sequence
MAARVLIIGSGGREHTLAWKLAQSHHVKQVLVAPG
NAGTACSEKISNTAISISDHTALAQFCKEKKIEFV
VVGPEAPLAAGIVGNLRSAGVQCFGPTAEAAQLES
SKRFAKEFMDRHGIPTAQWKAFTKPEEACSFILSA
DFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIM
QEKAFGAAGETIVIEELLDGEEVSCLCFTDGKTVA
PMPPAQDHKRLLEGDGGPNTGGMGAYCPAPQVSND
LLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLT
KNGPKVLEFNCRFGDPECQVILPLLKSDLYEVIQS
TLDGLLCTSLPVWLENHTALTVVMASKGYPGDYTK
GVEITGFPEAQALGLEVFHAGTALKNGKVVTHGGR
VLAVTAIRENLISALEEAKKGLAAIKFEGAIYRKD
VGFRAIAFLQQPR- Isotype
- IgG
- Antibody clone number
- 4D6-1D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Mass spectrometric/bioinformatic identification of a protein subset that characterizes the cellular activity of anticancer peptides.
Differentially expressed gene profile in the 6-hydroxy-dopamine-induced cell culture model of Parkinson's disease.
5,10-Methenyltetrahydrofolate synthetase activity is increased in tumors and modifies the efficacy of antipurine LY309887.
Genovese F, Gualandi A, Taddia L, Marverti G, Pirondi S, Marraccini C, Perco P, PelĂ M, Guerrini R, Amoroso MR, Esposito F, Martello A, Ponterini G, D'Arca D, Costi MP
Journal of proteome research 2014 Nov 7;13(11):5250-61
Journal of proteome research 2014 Nov 7;13(11):5250-61
Differentially expressed gene profile in the 6-hydroxy-dopamine-induced cell culture model of Parkinson's disease.
Noelker C, Schwake M, Balzer-Geldsetzer M, Bacher M, Popp J, Schlegel J, Eggert K, Oertel WH, Klockgether T, Dodel RC
Neuroscience letters 2012 Jan 17;507(1):10-5
Neuroscience letters 2012 Jan 17;507(1):10-5
5,10-Methenyltetrahydrofolate synthetase activity is increased in tumors and modifies the efficacy of antipurine LY309887.
Field MS, Anguera MC, Page R, Stover PJ
Archives of biochemistry and biophysics 2009 Jan 15;481(2):145-50
Archives of biochemistry and biophysics 2009 Jan 15;481(2):145-50
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GART monoclonal antibody (M01), clone 4D6-1D5 Western Blot analysis of GART expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GART expression in transfected 293T cell line by GART monoclonal antibody (M01), clone 4D6-1D5.Lane 1: GART transfected lysate(46 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to GART on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of GART transfected lysate using anti-GART monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GART MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to GART on formalin-fixed paraffin-embedded human endometrium tissue. [antibody concentration 2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol