HPA005779

GART antibody from Atlas Antibodies
GARS-AIRS-GART, PGFT, PRGS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005779
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005779, RRID:AB_1849484
Product name
Anti-GART
Provider product page
Atlas Antibodies - HPA005779
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LGDLLLTPTRIYSHSLLPVLRSGHVKAFAHITGGG
LLENIPRVLPEKLGVDLDAQTWRIPRVFSWLQQEG
HLSEEEMARTFNCGVGAVLVVSKEQTEQILRDIQQ
HKEEAWVIGSVVARAEGSPRVKVKNLIESMQINGS
VLKNGSLT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -