HPA002119

GART antibody from Sigma-Aldrich
PGFT, PRGS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002119
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002119, RRID:AB_1849482
Product name
Anti-GART antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002119
Antibody type
Polyclonal
Antigen
Trifunctional purine biosynthetic protein adenosine-3 [Includes: Phosphoribosylamine--glycine ligase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IEFVVVGPEAPLAAGIVGNLRSAGVQCFGPTAEAA
QLESSKRFAKEFMDRHGIPTAQWKAFTKPEEACSF
ILSADFPALVVKASGLAAGKGVIVAKSKEEACKAV
QEIMQEKAFGAAGETIVIEELLDGEEVSCLCFTDG
KTV
Storage
-20C
Provider Type Product Number
- No reagents -