Antibody data
- Antibody Data
 - Antigen structure
 - References [1]
 - Comments [0]
 - Validations
 - ELISA [1]
 - Immunoprecipitation [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00000048-M01 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00000048-M01, RRID:AB_464260
 - Product name
 - ACO1 monoclonal antibody (M01), clone 2C1
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant ACO1.
 - Antigen sequence
 RDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVI
PLEYLPGENADALGLTGQERYTIIIPENLKPQMKV
QVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMI
RKMAK- Isotype
 - IgG
 - Antibody clone number
 - 2C1
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
Submitted references		IF/TA-related metabolic changes--proteome analysis of rat renal allografts.
				
		
	
			Reuter S, Reiermann S, Wörner R, Schröter R, Edemir B, Buck F, Henning S, Peter-Katalinic J, Vollenbröker B, Amann K, Pavenstädt H, Schlatter E, Gabriëls G
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association 2010 Aug;25(8):2492-501
		Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association 2010 Aug;25(8):2492-501
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Detection limit for recombinant GST tagged ACO1 is approximately 0.3ng/ml as a capture antibody.
 - Validation comment
 - Sandwich ELISA (Recombinant protein)
 - Protocol
 - Protocol
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunoprecipitation of ACO1 transfected lysate using anti-ACO1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ACO1 MaxPab rabbit polyclonal antibody.
 - Validation comment
 - Immunoprecipitation
 - Protocol
 - Protocol