Antibody data

Product number
H00000216-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000216-M05, RRID:AB_1237639
Product name
ALDH1A1 monoclonal antibody (M05), clone 1G6
Provider product page
Abnova Corporation - H00000216-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ALDH1A1.
Antigen sequence
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSG
KKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQA
FQIGSPWRTMDASERGRLLYKLADLIERDRLLLAT
MESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKI
QGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVM
LIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIK
EAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFT
GSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLA
DADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESI
YDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
YDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPT
VFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVN
CYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVK
TVTVKISQKNS
Isotype
IgG
Antibody clone number
1G6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -