HPA002123

ALDH1A1 antibody from Sigma-Aldrich
ALDH1, PUMB1, RALDH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002123
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002123, RRID:AB_1844722
Product name
Anti-ALDH1A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002123
Antibody type
Polyclonal
Antigen
Retinal dehydrogenase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKE
QYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQP
TVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIK
RANNTFYGL
Storage
-20C
Provider Type Product Number
- No reagents -