HPA018104

TMEM87A antibody from Sigma-Aldrich
DKFZP564G2022
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018104
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018104, RRID:AB_1858135
Product name
Anti-TMEM87A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018104
Antibody type
Polyclonal
Antigen
Transmembrane protein 87A precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RPSANNQRFAFSPLSEEEEEDEQKEPMLKESFEGM
KMRSTKQEPNGNSKVNKAQEDDLKWVEENVPSSVT
DVALPALLDSDEERMITHFE
Storage
-20C
Provider Type Product Number
- No reagents -