Antibody data
- Product number
- HPA018104
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA018104, RRID:AB_1858135
- Product name
- Anti-TMEM87A
- Provider product page
- Atlas Antibodies - HPA018104
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RPSANNQRFAFSPLSEEEEEDEQKEPMLKESFEGM
KMRSTKQEPNGNSKVNKAQEDDLKWVEENVPSSVT
DVALPALLDSDEERMITHFE
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Liver tissue
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human prostate shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-TMEM87A antibody HPA018104.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis using Anti-TMEM87A antibody HPA018104.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human prostate shows strong cytoplasmic granular positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human pancreas shows strong cytoplasmic granular positivity in exocrine glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic granular positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic granular positivity in neurons.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human prostate and liver tissues using Anti-TMEM87A antibody. Corresponding TMEM87A RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex, liver, prostate and testis using Anti-TMEM87A antibody HPA018104 (A) shows similar protein distribution across tissues to independent antibody HPA018189 (B).
- Sample type
- HUMAN
- Antibody #2 product nr
- HPA018189
- Antibody provider
- Atlas Antibodies
- Independent Antibody Method
- ANTIBODY
- Show more
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex, gastrointestinal, pancreas and prostate using Anti-TMEM87A antibody HPA018104 (A) shows similar protein distribution across tissues to independent antibody HPA018189 (B).
- Antibody #2 product nr
- HPA018189
- Antibody provider
- Atlas Antibodies
- Show more