HPA018104

TMEM87A antibody from Atlas Antibodies
DKFZP564G2022

Antibody data

Product number
HPA018104
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018104, RRID:AB_1858135
Product name
Anti-TMEM87A
Provider product page
Atlas Antibodies - HPA018104
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RPSANNQRFAFSPLSEEEEEDEQKEPMLKESFEGM
KMRSTKQEPNGNSKVNKAQEDDLKWVEENVPSSVT
DVALPALLDSDEERMITHFE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.