HPA001823

SMPD1 antibody from Sigma-Aldrich
ASM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001823
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001823, RRID:AB_1857290
Product name
Anti-SMPD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001823
Antibody type
Polyclonal
Antigen
Sphingomyelin phosphodiesterase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGY
RVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAI
PHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQ
LFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLFAR
AD
Storage
-20C
Provider Type Product Number
- No reagents -