Antibody data

Product number
H00051567-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051567-M01, RRID:AB_1581585
Product name
TTRAP monoclonal antibody (M01), clone 3D11
Provider product page
Abnova Corporation - H00051567-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TTRAP.
Antigen sequence
MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASV
ASCDAAVAQCFLAENDWEMERALNSYFEPPVEESA
LERRPETISEPKTYVDLTNEETTDSTTSKISPSED
TQQENGSMFSLITWNIDGLDLNNLSERARGVCSYL
ALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHE
EGYFTAIMLKKSRVKLKSQEIIPFPSTKMMRNLLC
VHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVL
KKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNI
VDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRF
DRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSD
HWGLLCNLDIIL
Isotype
IgG
Antibody clone number
3D11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -