WH0003396M6

MRPL58 antibody from Sigma-Aldrich
DS-1, ICT1
ELISA
Recommended by provider

Antibody data

Product number
WH0003396M6
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0003396M6, RRID:AB_1842035
Product name
Monoclonal Anti-ICT1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0003396M6
Antibody type
Monoclonal
Antigen
ICT1 (NP_001536, a.a. 107-207) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
TAEWIAEPVRQKIAITHKNKINRLGELILTSESSR
YQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLH
RIRIENMNRERLRQKRIHSAVKTSRRVDMD* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -