HPA003634

MRPL58 antibody from Atlas Antibodies
DS-1, ICT1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003634
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003634, RRID:AB_1851388
Product name
Anti-MRPL58
Provider product page
Atlas Antibodies - HPA003634
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSD
IPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLA
TAEWIAEPVRQKIAITHKNKINRLGELILTSESSR
YQFRNLADCLQKIRDMI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -