HPA019881

ACOT13 antibody from Sigma-Aldrich
HT012, THEM2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019881
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019881, RRID:AB_1857978
Product name
Anti-THEM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019881
Antibody type
Polyclonal
Antigen
Thioesterase superfamily member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKT
LAFTSVDLTNKATGKLIAQGRHTKHLGN
Storage
-20C
Provider Type Product Number
- No reagents -