Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00114088-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00114088-M01, RRID:AB_509096
- Product name
- TRIM9 monoclonal antibody (M01), clone 1F12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRIM9.
- Antigen sequence
MEEMEEELKCPVCGSFYREPIILPCSHNLCQACAR
NILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSL
YSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPA
MPPP- Isotype
- IgG
- Antibody clone number
- 1F12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Negative regulation of NF-κB activity by brain-specific TRIpartite Motif protein 9.
A novel Netrin-1-sensitive mechanism promotes local SNARE-mediated exocytosis during axon branching.
Shi M, Cho H, Inn KS, Yang A, Zhao Z, Liang Q, Versteeg GA, Amini-Bavil-Olyaee S, Wong LY, Zlokovic BV, Park HS, García-Sastre A, Jung JU
Nature communications 2014 Sep 5;5:4820
Nature communications 2014 Sep 5;5:4820
A novel Netrin-1-sensitive mechanism promotes local SNARE-mediated exocytosis during axon branching.
Winkle CC, McClain LM, Valtschanoff JG, Park CS, Maglione C, Gupton SL
The Journal of cell biology 2014 Apr 28;205(2):217-32
The Journal of cell biology 2014 Apr 28;205(2):217-32
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TRIM9 expression in transfected 293T cell line by TRIM9 monoclonal antibody (M01), clone 1F12.Lane 1: TRIM9 transfected lysate(61.3 KDa).Lane 2: Non-transfected lysate.