Antibody data

Product number
H00114088-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00114088-M01, RRID:AB_509096
Product name
TRIM9 monoclonal antibody (M01), clone 1F12
Provider product page
Abnova Corporation - H00114088-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TRIM9.
Antigen sequence
MEEMEEELKCPVCGSFYREPIILPCSHNLCQACAR
NILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSL
YSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPA
MPPP
Isotype
IgG
Antibody clone number
1F12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.