HPA018830

FNTA antibody from Sigma-Aldrich
FPTA, PGGT1A, PTAR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018830
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018830, RRID:AB_1848992
Product name
Anti-FNTA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018830
Antibody type
Polyclonal
Antigen
Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAII
EEQPKNYQVWHHRRVLVEWLRDPSQELEFIADI
Storage
-20C
Provider Type Product Number
- No reagents -