HPA018162

YBEY antibody from Sigma-Aldrich
C21orf57
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018162
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018162, RRID:AB_1845699
Product name
Anti-C21orf57 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018162
Antibody type
Polyclonal
Antigen
Putative metalloprotease C21orf57 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSLVIRNLQRVIPIRRAPLRSKIEIVRRILGVQKF
DLGIICVDNKNIQHINRIYRDRNVPTDVLSFPFHE
HLKAGEFP
Storage
-20C
Provider Type Product Number
- No reagents -