HPA018162

YBEY antibody from Atlas Antibodies
C21orf57
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018162
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018162, RRID:AB_1668370
Product name
Anti-YBEY
Provider product page
Atlas Antibodies - HPA018162
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSLVIRNLQRVIPIRRAPLRSKIEIVRRILGVQKF
DLGIICVDNKNIQHINRIYRDRNVPTDVLSFPFHE
HLKAGEFP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -