HPA001824

MLLT3 antibody from Sigma-Aldrich
AF-9, AF9, YEATS3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001824
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001824, RRID:AB_1079394
Product name
Anti-MLLT3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001824
Antibody type
Polyclonal
Antigen
Protein AF-9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRS
IMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGS
RSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNN
NQILEVKSPIKQSKSDKQIKNGECDKAYLDELVEL
HRRLMTLR
Storage
-20C
Provider Type Product Number
- No reagents -