HPA005938

PRTN3 antibody from Atlas Antibodies
ACPA, AGP7, C-ANCA, MBT, P29, PR-3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005938
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005938, RRID:AB_1855764
Product name
Anti-PRTN3
Provider product page
Atlas Antibodies - HPA005938
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PTQQHFSVAQVFLNNYDAENKLNDILLIQLSSPAN
LSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHD
PPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGIC
FGDSGGPLICDGI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -