Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005938 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005938, RRID:AB_1855764
- Product name
- Anti-PRTN3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PTQQHFSVAQVFLNNYDAENKLNDILLIQLSSPAN
LSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHD
PPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGIC
FGDSGGPLICDGI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The intratumour microbiota and neutrophilic inflammation in squamous cell vulvar carcinoma microenvironment
Inflammatory Proteins HMGA2 and PRTN3 as Drivers of Vulvar Squamous Cell Carcinoma Progression
Rustetska N, Szczepaniak M, Goryca K, Bakuła-Zalewska E, Figat M, Kowalik A, Góźdź S, Kowalewska M
Journal of Translational Medicine 2023;21(1)
Journal of Translational Medicine 2023;21(1)
Inflammatory Proteins HMGA2 and PRTN3 as Drivers of Vulvar Squamous Cell Carcinoma Progression
Fatalska A, Rusetska N, Bakuła-Zalewska E, Kowalik A, Zięba S, Wroblewska A, Zalewski K, Goryca K, Domański D, Kowalewska M
Cancers 2020;13(1):27
Cancers 2020;13(1):27
No comments: Submit comment
No validations: Submit validation data