HPA005938

PRTN3 antibody from Sigma-Aldrich
ACPA, AGP7, C-ANCA, MBT, P29, PR-3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005938
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005938, RRID:AB_1855764
Product name
Anti-PRTN3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005938
Antibody type
Polyclonal
Antigen
Myeloblastin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTQQHFSVAQVFLNNYDAENKLNDILLIQLSSPAN
LSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHD
PPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGIC
FGDSGGPLICDGI
Storage
-20C
Provider Type Product Number
- No reagents -