HPA026631

NCAPG2 antibody from Atlas Antibodies
CAP-G2, FLJ20311, hCAP-G2, LUZP5, MTB
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026631
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026631, RRID:AB_1845983
Product name
Anti-NCAPG2
Provider product page
Atlas Antibodies - HPA026631
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QVGHILELVDNWLPTEHAQAKSNTASKGRVQIHDT
RPVKPELALVYIEYLLTHPKNRECLLSAPRKKLNH
LLKALETSKADLESLLQTPGGKPRGFSEAAAPRAF
GLHCRLSIHLQH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -