HPA026631

NCAPG2 antibody from Sigma-Aldrich
CAP-G2, FLJ20311, hCAP-G2, LUZP5, MTB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026631
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026631, RRID:AB_1845983
Product name
Anti-NCAPG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026631
Antibody type
Polyclonal
Antigen
Condensin-2 complex subunit G2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVGHILELVDNWLPTEHAQAKSNTASKGRVQIHDT
RPVKPELALVYIEYLLTHPKNRECLLSAPRKKLNH
LLKALETSKADLESLLQTPGGKPRGFSEAAAPRAF
GLHCRLSIHLQH
Storage
-20C
Provider Type Product Number
- No reagents -