HPA001825

DIABLO antibody from Atlas Antibodies
DFNA64, DIABLO-S, FLJ10537, FLJ25049, SMAC
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001825
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001825, RRID:AB_1857247
Product name
Anti-DIABLO
Provider product page
Atlas Antibodies - HPA001825
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGAR
AEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTG
ADQASITARNHIQLVKLQVEEVHQLSRKAETKLAE
AQIEELRQKTQEEG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -