H00054840-M02

APTX antibody from Abnova Corporation
AOA, AOA1, AXA1, EAOH, EOAHA, FLJ20157

Antibody data

Product number
H00054840-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054840-M02, RRID:AB_1203966
Product name
APTX monoclonal antibody (M02), clone 2H6
Provider product page
Abnova Corporation - H00054840-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant APTX.
Antigen sequence
KLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKK
HWNSFNTEYFLESQAVIEMVQEAGRVTVRDGMPEL
LKLPLRCHECQQLLPSIPQLKEHLRKHW
Isotype
IgG
Antibody clone number
2H6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -