Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486995 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Aprataxin (APTX) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-APTX antibody: synthetic peptide directed towards the middle region of human APTX
- Description
- Affinity Purified
- Reactivity
- Human, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
YPYIVEFEEEAKNPGLETHRKRKRSGNSDSIERDA
AQEAE AGTGLEPGSN- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Complete deletion of the aprataxin gene: ataxia with oculomotor apraxia type 1 with severe phenotype and cognitive deficit.
Yoon G, Westmacott R, MacMillan L, Quercia N, Koutsou P, Georghiou A, Christodoulou K, Banwell B
Journal of neurology, neurosurgery, and psychiatry 2008 Feb;79(2):234-6
Journal of neurology, neurosurgery, and psychiatry 2008 Feb;79(2):234-6
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting