Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29320 - Provider product page
- Provider
- Abnova Corporation
- Product name
- FARSA polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human FARSA.
- Antigen sequence
EVIEAELRSTKHWELTAEGEEIAREGSHEARVFRS
IPPEGLAQSELMRLPSGKVGFSKAMSNKWIRVDKS
AADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGE
KERSELRKRKLLAEVTLKTYWVSKG- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: Human cell line RT-4; Lane 2: Human cell line U-251MG sp; Lane 3: Human plasma (IgG/HSA depleted); Lane 4: Human liver tissue; Lane 5: Human tonsil tissue with FARSA polyclonal antibody (Cat# PAB29320) at 1:100-1:250 dilution.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with FARSA polyclonal antibody (Cat# PAB29320) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 with FARSA polyclonal antibody (Cat# PAB29320) under 1-4 ug/mL working concentration shows positivity in cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum with FARSA polyclonal antibody (Cat# PAB29320) shows strong cytoplasmic positivity in glandular cells at 1:1000-1:2500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)