HPA001911

FARSA antibody from Atlas Antibodies
CML33, FARSL, FARSLA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001911
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001911, RRID:AB_1848427
Product name
Anti-FARSA
Provider product page
Atlas Antibodies - HPA001911
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EVIEAELRSTKHWELTAEGEEIAREGSHEARVFRS
IPPEGLAQSELMRLPSGKVGFSKAMSNKWIRVDKS
AADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGE
KERSELRKRKLLAEVTLKTYWVSKG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -