H00023541-M05

SEC14L2 antibody from Abnova Corporation
C22orf6, KIAA1186, KIAA1658, SPF, TAP, TAP1

Antibody data

Product number
H00023541-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023541-M05, RRID:AB_1237861
Product name
SEC14L2 monoclonal antibody (M05), clone 2E5
Provider product page
Abnova Corporation - H00023541-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SEC14L2.
Antigen sequence
DIIGPLDAKGLLFSASKQDLLRTKMRECELLLQEC
AHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEA
YGEFLCMFEENYPETLKRLFVVKAPKLFP
Isotype
IgG
Antibody clone number
2E5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -