HPA023523

TTI2 antibody from Atlas Antibodies
C8orf41, FLJ23263
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023523
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023523, RRID:AB_1845776
Product name
Anti-TTI2
Provider product page
Atlas Antibodies - HPA023523
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLGKVETAKNSLVGPAWQTGLHHLAGPVYIFAITH
SLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFL
HGENEDEKG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -