Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB22351 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB22351, RRID:AB_10964333
- Product name
- TTI2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant TTI2.
- Antigen sequence
QEDSNLSEELSHSAFGQAFSKILHCLARPEARRGN
VKDAVLKDLGDLIEATGFDRLFEGTGARLRGMPET
LGQVAKALEKY- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: human plasma, Lane 4: liver, Lane 5: tonsil with TTI2 polyclonal antibody (Cat # PAB22351) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney with TTI2 polyclonal antibody (Cat # PAB22351) shows strong cytoplasmic positivity in tubular cells at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)