HPA023523

TTI2 antibody from MilliporeSigma / Merck KGaA
C8orf41, FLJ23263
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023523
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023523, RRID:AB_1845776
Product name
Anti-C8orf41 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023523
Antibody type
Polyclonal
Antigen
Uncharacterized protein C8orf41 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLGKVETAKNSLVGPAWQTGLHHLAGPVYIFAITH
SLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFL
HGENEDEKG
Storage
-20C
Provider Type Product Number
- No reagents -